PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11530_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 710aa    MW: 78480.2 Da    PI: 6.6869
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11530_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.7e-202479156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t++q+++Le +F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Neem_11530_f_2 24 KKRYHRHTAHQIQRLEGMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 79
                    678899***********************************************998 PP

2START180.78.3e-572224432206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a  a++el+++ + +ep+W+kss    + +n + + + f+++++       ++ea+r+sgvv+m+   lv  ++d + +W e ++     a+t+
  Neem_11530_f_2 222 IAANAMEELLRLLQTNEPLWMKSSadgrDVLNLESYERMFPRANShlknpnVRIEASRDSGVVIMNGLALVDMFMDCN-KWVELFPtivsMAKTI 315
                     67889*******************9999888889999999888889999999**************************.******999999**** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     evissg      g lqlm+ elq+lsplvp R+f+++Ry++q ++g w+iv vS d  q+ ++     R++++pSg+li++++ng+skvtwvehv
  Neem_11530_f_2 316 EVISSGmlgthsGSLQLMYEELQVLSPLVPtREFYILRYCQQIEQGLWAIVNVSYDFSQFASQ----YRSHRFPSGCLIQDMPNGYSKVTWVEHV 406
                     ************************************************************986....9*************************** PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     ++++r p h l+r l++sgla ga +w+atlqr ce+
  Neem_11530_f_2 407 EVEDRAPlHRLYRELIQSGLALGAERWLATLQRMCER 443
                     ***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-21781IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-231183IPR009057Homeodomain-like
PROSITE profilePS5007117.8312181IPR001356Homeobox domain
SMARTSM003895.6E-192285IPR001356Homeobox domain
CDDcd000862.12E-182382No hitNo description
PfamPF000466.6E-182479IPR001356Homeobox domain
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084853.346212446IPR002913START domain
SuperFamilySSF559615.5E-38213444No hitNo description
CDDcd088752.40E-119216442No hitNo description
SMARTSM002349.1E-49221443IPR002913START domain
PfamPF018523.5E-49222443IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-8286442IPR023393START-like domain
SuperFamilySSF559611.05E-23464702No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MEFGSGGGSG SGGDHDGSDP QRRKKRYHRH TAHQIQRLEG MFKECPHPDE KQRLQLSREL  60
GLAPRQIKFW FQNRRTQMKA QHERADNCAL RAENDKIRCE NIAIREALKN VICPSCGGPP  120
VSEDSYFDEQ KLRMENTQLK EELDRVSSIA AKYIGRPISQ LPPVQPIHIS SLDLTMGSFG  180
SQGIGGPSLD LDLLPGSSSN MPNFPFQQIV LSDMDKSLMT DIAANAMEEL LRLLQTNEPL  240
WMKSSADGRD VLNLESYERM FPRANSHLKN PNVRIEASRD SGVVIMNGLA LVDMFMDCNK  300
WVELFPTIVS MAKTIEVISS GMLGTHSGSL QLMYEELQVL SPLVPTREFY ILRYCQQIEQ  360
GLWAIVNVSY DFSQFASQYR SHRFPSGCLI QDMPNGYSKV TWVEHVEVED RAPLHRLYRE  420
LIQSGLALGA ERWLATLQRM CERFACLMVS GNSTRDLGGV IPSPDGKRSM MKLAQRMVSN  480
FCTSISTSNS HRWTTLSGLN EVGVRVALHK STDPGQPNGV VLNAATTFWL PVSPQNVFNF  540
FKDERTRPQW DVLSNGNGVQ EVAHIANGSH PGNCISVLRA FNTSQNNMLI LQESCIDNSG  600
SLVVYCPVDL PAINIAMSGE DPSYIPLLPS GFTISPDGHL DQGGDGASTS SNVHGNMGSR  660
SSGSLITVAF QILVSSLPSA KLNMESVTTV NNLIGTTVQQ IKAALNCPSS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006478112.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0D2UBV50.0A0A0D2UBV5_G
STRINGPOPTR_0015s05050.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11